S100A7, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


S100A7, Human
Description :
The S100A7 protein is known to interact with RANBP9, suggesting a potential functional relationship between the two molecules. S100A7 Protein, Human is the recombinant human-derived S100A7 protein, expressed by E. coli , with tag free.Product Name Alternative :
S100A7 Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/s100a7-protein-human.htmlPurity :
98.0Smiles :
MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQMolecular Formula :
6278 (Gene_ID) P31151 (M1-Q101) (Accession)Molecular Weight :
Approximately 14.0 kDaShipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

