Recombinant Human Prokineticin-1 protein (PROK1) (Active)

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS950669-02	Recombinant Human Prokineticin-1 (PROK1)
MBS950669-01	Recombinant Human Prokineticin-1 (PROK1)
MBS950669-05	Recombinant Human Prokineticin-1 (PROK1)
MBS950669-03	Recombinant Human Prokineticin-1 (PROK1)
MBS950669-04	Recombinant Human Prokineticin-1 (PROK1)
abx904260-15nmol	Human Prokineticin 1 siRNA
AP87328	Prokineticin-1
AP79937	Prokineticin-1
abx904260-30nmol	Human Prokineticin 1 siRNA
MBS9423153-03	Recombinant Human Prokineticin-1 protein (PROK1)

CAT:

399-CSB-AP002671HU-03

Size:

5 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Prokineticin-1 protein (PROK1) (Active)

Gene Name: PROK1, UNQ600/PRO1186
UniProt: P58294
Expression Region: 20-105aa
Organism: Homo sapiens
Target Sequence: AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
Tag: Tag-Free
Source: E.Coli
Field of Research: Signal Transduction
Assay Type: Active Protein & In Stock Protein
Relevance: Potently contracts gastrointestinal (GI) smooth muscle. Induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. Has little or no effect on a variety of other endothelial and non-endothelial cell types. Induces proliferation and differentiation, but not migration, of enteric neural crest cells. Directly influences neuroblastoma progression by promoting the proliferation and migration of neuroblastoma cells. Positively regulates PTGS2 expression and prostaglandin synthesis. May play a role in placentation. May play a role in normal and pathological testis angiogenesis. {ECO:0000269|PubMed:11259612, ECO:0000269|PubMed:11528470, ECO:0000269|PubMed:15292351, ECO:0000269|PubMed:17289879, ECO:0000269|PubMed:18339712}.
Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
Purity: >98% as determined by SDS-PAGE.
Activity: Yes
Bioactivity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using bovine EJG cells is less than 2.0 μg/ml, corresponding to a specific activity of ＞ 500 IU/mg.
Length: Full Length of Mature Protein
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4, 0.02 % Tween-20
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function: Potently contracts gastrointestinal (GI) smooth muscle. Induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. Has little or no effect on a variety of other endothelial and non-endothelial cell types. Induces proliferation and differentiation, but not migration, of enteric neural crest cells. Directly influences neuroblastoma progression by promoting the proliferation and migration of neuroblastoma cells. Positively regulates PTGS2 expression and prostaglandin synthesis. May play a role in placentation. May play a role in normal and pathological testis angiogenesis.
Molecular Weight: 9.7 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Prokineticin-1 protein (PROK1) (Active), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
CSB-AP002671HU-03	Recombinant Human Prokineticin-1 protein (PROK1) (Active)
CSB-AP002671HU-02	Recombinant Human Prokineticin-1 protein (PROK1) (Active)
CSB-AP002671HU-01	Recombinant Human Prokineticin-1 protein (PROK1) (Active)
CSB-E04532h-04	Human prokineticin 1 (PROK1/EG-VEGF) ELISA Kit
CSB-E04532h-03	Human prokineticin 1 (PROK1/EG-VEGF) ELISA Kit
CSB-E04532h-02	Human prokineticin 1 (PROK1/EG-VEGF) ELISA Kit
CSB-E04532h-01	Human prokineticin 1 (PROK1/EG-VEGF) ELISA Kit
CSB-EP879446MO-03	Recombinant Mouse Prokineticin-2 (Prok2)
CSB-EP879446MO-02	Recombinant Mouse Prokineticin-2 (Prok2)
CSB-EP879446MO-01	Recombinant Mouse Prokineticin-2 (Prok2)