Recombinant Mouse Prokineticin-2 (Prok2) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS7611563-01	Recombinant Mouse Prokineticin 2
MBS7611563-02	Recombinant Mouse Prokineticin 2
MBS7611563-04	Recombinant Mouse Prokineticin 2
MBS7611563-03	Recombinant Mouse Prokineticin 2
MBS1349458-002mgEColi	Recombinant Mouse Prokineticin-2 (Prok2)
MBS1349458-002mgYeast	Recombinant Mouse Prokineticin-2 (Prok2)
MBS1349458-01mgEColi	Recombinant Mouse Prokineticin-2 (Prok2)
MBS1349458-002mgBaculovirus	Recombinant Mouse Prokineticin-2 (Prok2)
MBS1349458-01mgYeast	Recombinant Mouse Prokineticin-2 (Prok2)
abx929877-15nmol	Mouse Prokineticin 2 siRNA

Recombinant Mouse Prokineticin-2 (Prok2)

CAT:

399-CSB-EP879446MO-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Mouse Prokineticin-2 (Prok2)

Gene Name: Prok2
UniProt: Q9QXU7
Expression Region: 27-128aa
Organism: Mus musculus
Target Sequence: AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKSHVANGRQERRRAKRRKRKKEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK
Tag: N-terminal 6xHis-B2M-tagged
Source: E.coli
Field of Research: Cancer
Assay Type: Developed Protein
Relevance: May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle .
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 25.5 kDa
References & Citations: "Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus." Cheng M.Y., Bullock C.M., Li C., Lee A.G., Bermak J.C., Belluzzi J., Weaver D.R., Leslie F.M., Zhou Q.-Y. Nature 417:405-410 (2002)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Mouse Prokineticin-2 (Prok2), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP879446MO-03	Recombinant Mouse Prokineticin-2 (Prok2)
CSB-EP879446MO-02	Recombinant Mouse Prokineticin-2 (Prok2)
CSB-EP879446MO-01	Recombinant Mouse Prokineticin-2 (Prok2)
CSB-EL018747MO-01	Mouse Prokineticin-2 (PROK2) ELISA Kit
CSB-EL018747MO-04	Mouse Prokineticin-2 (PROK2) ELISA Kit
CSB-EL018747MO-03	Mouse Prokineticin-2 (PROK2) ELISA Kit
CSB-EL018747MO-02	Mouse Prokineticin-2 (PROK2) ELISA Kit
CSB-EL018747RA-02	Rat Prokineticin-2(PROK2) ELISA kit
CSB-EL018747RA-01	Rat Prokineticin-2(PROK2) ELISA kit
CSB-EL018747RA-03	Rat Prokineticin-2(PROK2) ELISA kit

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on