Recombinant Mouse Prokineticin-2 (Prok2)

CAT:
399-CSB-EP879446MO-02
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Prokineticin-2 (Prok2) - image 1

Recombinant Mouse Prokineticin-2 (Prok2)

  • CAS Number:

    9000-83-3
  • Gene Name:

    Prok2
  • UniProt:

    Q9QXU7
  • Expression Region:

    27-128aa
  • Organism:

    Mus musculus
  • Target Sequence:

    AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKSHVANGRQERRRAKRRKRKKEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK
  • Tag:

    N-terminal 6xHis-B2M-tagged
  • Source:

    E.coli
  • Field of Research:

    Cancer
  • Assay Type:

    Developed Protein
  • Relevance:

    May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle .
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Full Length of Mature Protein
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    25.5 kDa
  • References & Citations:

    "Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus." Cheng M.Y., Bullock C.M., Li C., Lee A.G., Bermak J.C., Belluzzi J., Weaver D.R., Leslie F.M., Zhou Q.-Y. Nature 417:405-410 (2002)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.