Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3) (Active)

CAT:
399-CSB-MP007125MOV-03
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3) (Active) - image 1
Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3) (Active) - image 2
Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3) (Active) - image 3
Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3) (Active) - image 4
Thumbnail 1
Thumbnail 2
Thumbnail 3
Thumbnail 4

Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3) (Active)

  • CAS Number:

    9000-83-3
  • Gene Name:

    DPEP3
  • UniProt:

    Q4R7M2
  • Expression Region:

    36-463aa
  • Organism:

    Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
  • Target Sequence:

    GETTTGAPRALSTLGFPSPFTTPGVPSTLTTPGLTTPGTTKTLDLRSRAQALMRDFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHSQTSLDRLRDGLVGAQFWSASVSCQTQDQTAVRLALEQIDLIRRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCNTPWAESSTKFTHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLMRRVLEVSRAPVIFSHSAARAVCDNSLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGAGRFPQGLEDVSTYPVLIEELLSRSWSEKELQGVLRGNLLRVFRQAEKVREESRAQSPMEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKWPTNRVPWRS
  • Tag:

    C-terminal 10xHis-tagged
  • Source:

    Mammalian cell
  • Field of Research:

    Cancer
  • Assay Type:

    Active Protein & In Stock Protein
  • Relevance:

    Lacks dipeptidase activity and is unable to hydrolyze cystinyl-bis-glycine, leukotriene D4 and the beta-lactam antibiotic imipenem. The absence of activity may be due to the inability of asparagine (instead of aspartate found in DPEP1/2) at position 359 to function as the acid/base catalyst and activate the nucleophilic water/hydroxide. A tyrosine (instead of histidine) at position 269 reduces affinity for the beta zinc and may cause substrate steric hindrance.
  • Endotoxin:

    Less than 1.0 EU/ug as determined by LAL method.
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis DPEP3 at 2 μg/mL can bind Anti-DPEP3 recombinant antibody (CSB-RA007125MA1HU). The EC50 is 7.817-8.936 ng/mL.
  • Length:

    Full Length of Mature Protein
  • Form:

    Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    48.5 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • Protein Length:

    Full Length of Mature Protein