Products for Research Use Only
RegisterLogin

CD81, Human (His-SUMO)

CAT: 0804-HY-P72126Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P72126Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The CD19 receptor is critical for B cell activation, driving the trafficking and assembly of CD19-CR2 and BCR complexes, thereby lowering the antigenic threshold for B cell clonal expansion. In T cells, CD19 contributes to CD3 localization and influences polarization. CD81 Protein, Human (His-SUMO) is the recombinant human-derived CD81 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Product Name Alternative
CD81 Protein, Human (His-SUMO), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd81-protein-human-his-sumo.html
Smiles
FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular Formula
975 (Gene_ID) P60033 (F113-K201) (Accession)
Molecular Weight
Approximately 25.8 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P74264-01CD81, Human (HEK293, His)
HY-P704529CDK5, Human (His-SUMO)
HY-P72080-01APOBEC3A, Human (His-SUMO)
HY-P700595PRPS1, Human (His-SUMO)
HY-P70700-01TMEM173, Human (Sumo-His)
HY-P72116-01CAPZA2, Human (His-SUMO)
HY-P71599DENND1A, Human (His-SUMO)
HY-P73700PRAC, Human (His-SUMO)
HY-P71607-01KLRG1, Human (His-SUMO)
HY-P71532-01MYBPC3, Human (His-SUMO)

Alternative Products

CatalogName
P502264CD81 Protein (N-His-SUMO, Human)
TMPH-01073-01CD81 Protein, Human, Recombinant (His & SUMO)
HX855022-01Recombinant Human CD81 Protein, N-His-SUMO
372684-01CD81, Recombinant, Human, aa113-201, His-SUMO-Tag
GTR19142729Recombinant Human CD81 (His)
QP5797-ec-200ugRecombinant Human CD81/ TAPA-1 Protein, His-SUMO, E.coli-200ug
QP5797-ec-1mgRecombinant Human CD81/ TAPA-1 Protein, His-SUMO, E.coli-1mg
QP5797-ec-10ugRecombinant Human CD81/ TAPA-1 Protein, His-SUMO, E.coli-10ug
QP5797-ec-50ugRecombinant Human CD81/ TAPA-1 Protein, His-SUMO, E.coli-50ug
QP5797-ec-500ugRecombinant Human CD81/ TAPA-1 Protein, His-SUMO, E.coli-500ug

Popular Products