Products for Research Use Only
RegisterLogin

SENP8, Human (His)

CAT: 0804-HY-P71290Size: 1 EachDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71290Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
SENP8 protein, a pivotal protease in the NEDD8 pathway, plays a dual role in catalyzing the processing of full-length NEDD8 into its mature form and facilitating the deconjugation of NEDD8 from specific target proteins, including cullins and p53. SENP8's dual functionality underscores its crucial role in regulating NEDD8 modification, impacting various cellular pathways and functions. SENP8 Protein, Human (His) is the recombinant human-derived SENP8 protein, expressed by E. coli , with N-6*His labeled tag.
Product Name Alternative
SENP8 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/senp8-protein-human-his.html
Smiles
MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK
Molecular Formula
123228 (Gene_ID) Q96LD8 (M1-K212) (Accession)
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS12677SENP8 Human Pre-designed siRNA Set A
HY-P89024SENP8 Antibody (YA8708, Mouse)
HY-RS25974Senp8 Rat Pre-designed siRNA Set A
HY-RS19481Senp8 Mouse Pre-designed siRNA Set A
HY-P79459-01SENP1 Catalytic Domain, Human (His)
HY-P701470SENP5, Human
HY-P71288-01SENP2, Human
HY-P71289SENP7, Human
HY-P701468SENP3, Human
HY-P76688UBE2F, Human (His)

Alternative Products

CatalogName
TMPJ-01278-01SENP8 Protein, Human, Recombinant (His)
P528350SENP8 Protein (N-His, Human)
YHP08701Recombinant Human SENP8 Protein, N-His
KMH1686-01Recombinant Human SENP8 Protein, His Tag
PKSH033028-01Recombinant Human SENP8 Protein (His Tag)
PV037364SENP8 Protein Vector (Human) (pPM-C-His)
AR39052PU-NSENP8 (1-212, His-tag) Human Protein
PV037362SENP8 Protein Vector (Human) (pPB-N-His)
PV037361SENP8 Protein Vector (Human) (pPB-C-His)
E53A03884SENP8, 1-212aa, Human, His tag, E.coli

Popular Products