Goat anti-Envelope Protein (SARS-CoV-2) Polyclonal antibody

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
18957-1	Anti-SARS Envelope Protein
18958-1	Anti-SARS Envelope Protein
E40YR1615	Anti-Envelope protein E
MBS156718-02	Anti-Envelope protein E
18957	Anti-SARS Envelope Protein
18958	Anti-SARS Envelope Protein
18957	Anti-SARS Envelope Protein
18958	Anti-SARS Envelope Protein
MBS156718-01	Anti-Envelope protein E
MBS156718-03	Anti-Envelope protein E

CAT:

894-AB0399-100

Size:

300 µg

Price:

Ask

For price, please contact [email protected].

Goat anti-Envelope Protein (SARS-CoV-2) Polyclonal antibody

Description: Envelope (E) is one of the structural proteins of the virus. This protein is a small polypeptide that contains at least one α-helical transmembrane domain and it involved in life cycle of SARS-CoV-2, such as assembly, budding, envelope formation.
Specifications: In lysates of transfected cells with the plasmid containing the sequence used, detects the fusion protein by Western blot.
Alternative Name: ORF4, E SARS Coronavirus-2 antibody.
Volume: 100 µL
Host: Goat
Antigen Species: SARS-CoV-2
Reactivity: Reacts with SARS-CoV-2 protein
Immunogen: Affinity purified recombinant fusion protein using the C-terminal of Envelope protein (residues 45 to stop) and produced in E. coli.
Target Antigen: Affinity purified recombinant fusion protein using the C-terminal of Envelope protein (residues 45 to stop) and produced in E. coli.
Immunogen Type: Recombinant protein
Target: anti-Envelope Protein (SARS-CoV-2)
Clonality: Polyclonal
Isotype: IgG
Conjugation: Unconjugated
Type: Primary
Sequence: MNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
Applications: WB
Purification: Epitope affinity purified
Concentration: 3 mg/mL
Dilution: WB:1:500-1:2,000
Form: Polyclonal antibody supplied as a 100 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Buffer: PBS, 20% glycerol and 0.05% sodium azide
Storage Conditions: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.

Complementary Product Range

Our range of products, including Goat anti-Envelope Protein (SARS-CoV-2) Polyclonal antibody, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
AB0399-100	Goat anti-Envelope Protein (SARS-CoV-2) Polyclonal antibody
AB0099-200	Goat anti-Random protein Polyclonal antibody
AB1400-100	Goat anti-anti-mTangerine Polyclonal antibody
AB0060-200	Goat anti-MBP Polyclonal antibody
AB0131-200	Goat anti-Luciferase Polyclonal antibody
AB181550-100	Goat anti-tdTomato Polyclonal antibody
AB41405-100	Goat anti-CANX Polyclonal antibody
AB0165-100	Goat anti-GFAP Polyclonal antibody
AB0198-200	Goat anti-Rab35 Polyclonal antibody
AB0277-100	Goat anti-NPY1R Polyclonal antibody