Goat anti-ORF3a (SARS-CoV-2) Polyclonal antibody

• Description:

  ORF3a encodes a viral accessory and uncharacterised protein with possible role in the viral life cycle. Six functional domains have been identified and have linked to infectivity, virulence, ion channel formation and virus release.

• Specifications:

  In lysates of transfected cells with the plasmid containing the sequence used, detects the fusion protein by Western blot.

• Product Name Alternative:

  ORF3a SARS Coronavirus-2 antibody.

• Volume:

  100 µL

• Host:

  Goat

• Antigen Species:

  SARS-CoV-2

• Reactivity:

  Reacts with SARS-CoV-2 protein

• Immunogen:

  Affinity purified fusion recombinant protein using the C-terminal of ORF3a (residues 160 to stop) and produced in E. coli.

• Target Antigen:

  Affinity purified fusion recombinant protein using the C-terminal of ORF3a (residues 160 to stop) and produced in E. coli.

• Immunogen Type:

  Recombinant protein

• Target:

  anti-ORF3a (SARS-CoV-2)

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Conjugation:

  Unconjugated

• Type:

  Primary

• Sequence:

  MNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL

• Applications:

  WB

• Purification:

  Epitope affinity purified

• Concentration:

  3 mg/mL

• Dilution:

  WB:1:500-1:2,000

• Form:

  Polyclonal antibody supplied as a 100 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

• Buffer:

  PBS, 20% glycerol and 0.05% sodium azide

• Storage Conditions:

  For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.

• CAS Number:

  9007-83-4