Goat anti-GAPDH Polyclonal antibody

Goat anti-GAPDH Polyclonal antibody

• Description: Goat polyclonal to GAPDH (glyceraldehyde 3-phosphate dehydrogenase). GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains.
• Specifications: Detects a band of 37 kDa by Western blot in the following human (293A, HMEC-1, U-118, HaCat), rat (TR-iBRB), mouse (AtT-20, Hepa), canine (D17) and monkey (COS-7) whole cell lysates.
• Product Name Alternative: glyceraldehyde 3-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, G3PD, GAPD, HGNC:4141, GAPDH antibody.
• CAS Number: 9007-83-4
• UNSPSC Description: Glyceraldehyde-3-phosphate dehydrogenase
• Volume: 200 µL
• Gene ID: ENSG00000111640
• Accession Number: ENSG00000111640
• Host: Goat
• Antigen Species: Human
• Reactivity: Human, mouse, rat, bovine, canine, chicken/avian, donkey, feline, goat, guinea pig, hamster, horse, porcine, rabbit, sheep, simian, other
• Immunogen: Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.
• Target Antigen: Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.
• Immunogen Type: Recombinant protein
• Target: Anti-GAPDH
• Clonality: Polyclonal
• Isotype: IgG
• Conjugation: Unconjugated
• Type: Primary
• Sequence: SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
• Applications: WB, IF, IHC-P, IHC-F
• Purification: Epitope affinity purified
• Concentration: 2 mg/mL
• Dilution: WB:1:500-1:10,000, IF:1:50-1:250, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000
• Form: Polyclonal antibody supplied as a 200 µl (2 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Buffer: PBS, 20% glycerol and 0.05% sodium azide
• References & Citations: 1. Ramos S, Ademolue TW, Jentho E, et al. Cell Metab 2022 Aug. PMID: 35841892 2. Broughton K, Korski K, Echeagaray O, et al. Gene Ther. 2019 Aug. PMID:31239537 3. Korski KI, Kubli DA, Wang BJ, et al. Stem Cells. 2019 Jan. PMID:30629785 4. Broughton K, Korski K, Echeagaray O, et al. bioRxiv 521732; Jan 2019 5. Korski KI,MSc Thesis, Univ San Diego, USA, 2018 6. Choudhury SS, MSc Thesis, Univ San Diego, USA, 2018 7. Sacchi V, Wang BJ, Kubli D, et al. J Am Heart Assoc. 2017 Oct (Supplemental Information). PMID:29018025 8. Khalafalla FG, Kayani W, Kassab A, et al. J Physiol. 2017 Oct. PMID:28980705 9. Firouzi F, MSc Thesis, San Diego State University, USA, 2017 10. Gonçalves A, Lin CM, Muthusamy A, et al. Invest Ophthalmol Vis Sci. 2016 May. PMID: 27163772 11. Hyenne V, Apaydin A, Rodriguez D, et al. J Cell Biol. 2015 Oct. PMID: 26459596 12. Helsby MA, Leader PM, Fenn JR. BMC Cell Biol. 2014 Feb. PMID: 24528853 13. Grilo mLJ, MSc Thesis, University of Coimbra, Portugal, 2014 14. Matos CTSM, PhD Thesis, NOVA University of Lisbon, Portugal, 2013
• Storage Conditions: For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.