Goat anti-GAPDH Polyclonal antibody

CAT:
894-AB49680-100
Size:
250 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Goat anti-GAPDH Polyclonal antibody - image 1

Goat anti-GAPDH Polyclonal antibody

  • Description:

    Goat polyclonal to GAPDH (glyceraldehyde 3-phosphate dehydrogenase) conjugated to DyLight® 680. GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains.
  • Specifications:

    Detects a band of 37 kDa by Western blot.
  • Product Name Alternative:

    glyceraldehyde 3-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, G3PD, GAPD, HGNC:4141, GAPDH antibody.
  • UNSPSC Description:

    Glyceraldehyde-3-phosphate dehydrogenase
  • Volume:

    100 µL
  • Gene ID:

    ENSG00000111640
  • Accession Number:

    ENSG00000111640
  • Host:

    Goat
  • Antigen Species:

    Human
  • Reactivity:

    Reacts against human, rat, mouse, zebrafish, canine and monkey proteins.
  • Immunogen:

    Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.
  • Target Antigen:

    Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.
  • Immunogen Type:

    Recombinant protein
  • Target:

    Anti-GAPDH, DyLight®680
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Conjugation:

    DyLight®680
  • Type:

    Primary
  • Sequence:

    SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
  • Applications:

    WB, IF, IHC-F
  • Purification:

    Epitope affinity purified
  • Concentration:

    2.5 mg/mL
  • Dilution:

    WB:1:500-1:5,000, IF:1:50-1:250, IHC-F:1:200-1:1,000
  • Form:

    Polyclonal antibody supplied as a 100 µl (2.5 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
  • Buffer:

    PBS, 20% glycerol and 0.05% sodium azide
  • Storage Conditions:

    For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
  • CAS Number:

    9007-83-4