Goat anti-GAPDH Polyclonal antibody
CAT:
894-AB49680-100
Size:
250 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

Goat anti-GAPDH Polyclonal antibody
- Description: Goat polyclonal to GAPDH (glyceraldehyde 3-phosphate dehydrogenase) conjugated to DyLight® 680. GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains.
- Specifications: Detects a band of 37 kDa by Western blot.
- Product Name Alternative: glyceraldehyde 3-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, G3PD, GAPD, HGNC:4141, GAPDH antibody.
- CAS Number: 9007-83-4
- UNSPSC Description: Glyceraldehyde-3-phosphate dehydrogenase
- Volume: 100 µL
- Gene ID: ENSG00000111640
- Accession Number: ENSG00000111640
- Host: Goat
- Antigen Species: Human
- Reactivity: Reacts against human, rat, mouse, zebrafish, canine and monkey proteins.
- Immunogen: Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.
- Target Antigen: Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.
- Immunogen Type: Recombinant protein
- Target: Anti-GAPDH, DyLight®680
- Clonality: Polyclonal
- Isotype: IgG
- Conjugation: DyLight®680
- Type: Primary
- Sequence: SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
- Applications: WB, IF, IHC-F
- Purification: Epitope affinity purified
- Concentration: 2.5 mg/mL
- Dilution: WB:1:500-1:5,000, IF:1:50-1:250, IHC-F:1:200-1:1,000
- Form: Polyclonal antibody supplied as a 100 µl (2.5 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
- Buffer: PBS, 20% glycerol and 0.05% sodium azide
- Storage Conditions: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.