Goat anti-tdTomato Polyclonal antibody
CAT:
894-AB8181-200
Size:
600 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

Goat anti-tdTomato Polyclonal antibody
- Description: Goat polyclonal antibody to tdTomato (red fluorescent protein). tdTomato protein is derived from DsRed, an engineered red fluorescent protein from so-called disc corals of the genus Discosoma. It is a genetic fusion of two copies of the dTomato gene, which has been specifically designed for low aggregation. It´s brightness and emission wavelength, makes it ideal for live animal research.
- Specifications: In 293HEK cells transfected with cds plasmid detects a band of 55 kDa by Western blot. It also detects tdTomato in brain sections by IHC. This antibody (AB8181) is specific for tdTomato and mCherry proteins. It does not cross-react to GFP (green fluorescent protein).
- Product Name Alternative: Cherry fluorescent protein; DsRed, mCherry, red fluorescent protein, RFP antibody.
- CAS Number: 9007-83-4
- UNSPSC Description: Red Fluorescent Protein
- Volume: 200 µL
- Host: Goat
- Reactivity: tdTomato, mCherry, RFP
- Immunogen: Purified recombinant peptide produced in E. coli.
- Target Antigen: Purified recombinant peptide produced in E. coli.
- Immunogen Type: Recombinant protein
- Target: anti-tdTomato
- Clonality: Polyclonal
- Isotype: IgG
- Conjugation: Unconjugated
- Type: Primary
- Sequence: MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
- Applications: WB, IF, IHC-P, IHC-F, IEM
- Purification: Epitope affinity purified
- Concentration: 3 mg/mL
- Dilution: WB:1:500-1:2,000, IF:1:50-1:500, IHC-P:1:50-1:500, IHC-F:1:50-1:500, IEM:1:50-1:500
- Form: Polyclonal antibody supplied as a 200 or 500 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Buffer: PBS, 20% glycerol and 0.05% sodium azide
- References & Citations: 1. Wu Y, Bottes S, Fisch R, et al. Nat Aging 2023 Apr. PMID: 37117787 2. Tran HN, Nguyen QH, Jeong JN, et al. Cell Death Differ 2023 Apr. PMID: 37081114 3. Frezel N, Ranucci M, Foster E, et al. Cell Rep 2023 Mar. PMID: 36947543 4. Mätlik K, Govek EE, Paul MR, et al. bioRxiv 2023 5. Albors AR, Singer GA, Llorens-Bobadilla E, et al. Dev Cell 2023 Jan. PMID: 36706756 6. Nichols AEC, Wagner NW, Ketonis C, et al. bioRxiv 2023 7. Lorincz R, Alvarez AB, Walkey CJ, et al. Biomed Pharmacother 2022 Dec. PMID: 36587560 8. Hu H, Duan Y, Wang K, et al. Cell Rep 2022 Dec. PMID: 36476878 9. Cattaneo P, Hayes MGB, Baumgarten N, et al. Nat Commun 2022 Dec. PMID: 36460641 10. Wei F, Uchihara T, Yonemura A, et al. FEBS J 2022 Dec. PMID: 36565059 11. Ackerman JE, Best KT, Muscat SN, et al. Cell Rep 2022 Nov. PMID: 36417854 12. Kevely A, Pranclova V, Slavikova M, et al. Viruses 2022 Nov. PMID: 36560677 13. Flavia Roşianu F, Mihaylov SR, Eder N, et al. Life Sci Alliance 2022 Nov. PMID: 36446521 14. Wu D, Poddar A, Ninou E, et al. Cell Genom 2022 Nov. PMID: 36381608 15. Huang X, Yan L, Meng J, et al. Sci China Life Sci 2022 Oct. PMID: 36322324 16. Albisetti GW, Ganley RP, Pietrafesa F, et al. Neuron 2022 Oct. PMID: 36323322 17. Pu X, Zhu P, Zhou X, et al. Cell Mol Life Sci 2022 Oct. PMID: 36315271 18. Gregorio RD, Subah G, Chan JC, et al. Development 2022 Sep PMID: 36178075 19. Sparano C, Solís-Sayago D, Vijaykumar A, et al. Sci Immunol 2022 Sep. PMID: 36054340 20. Rastegar-Pouyani S, Kennedy TE, Kania A. J Neurosci 2022 Aug. PMID: 36028316 21. Koba S, Kumada N, Narai E, et al. Nat Commun 2022 Aug. PMID: 36038592 22. Gesuita L, Cavaccini A, Argunsah AO, et al. Cell Rep 2022 Aug. PMID: 35977514 23. Venkataramanappa S, Saaber F, Abe P, et al. Cell Rep 2022 Aug. PMID: 35926459 24. Kotas ME, Moore CM, Gurrola JG, et al. JCI Insight 2022 Jul. PMID: 35608904 25. Owoc MS, Rubio ME, Brockway B, et al. Hear Res 2022 Jul. PMID: 35617926 26. Xu Y, Zhao J, Ren Y, et al. Cell Res 2022 Jun. PMID: 35508506 27. Radecki KC, Ford MJ, Phillipps HR, et al. FASEB Bioadv 2022 Apr. PMID: 35812077 28. Nemeth DP, Liu X, McKim DB, et al. J Inflamm Res 2022 Mar. PMID: 35282272 29. Abed S, Reilly A, Arnold SJ, et al. Front Cell Neurosci 2022 Mar. PMID: 35401124 30. Jeon HY, Choi J, Kraaier L, et al. EMBO J 2022 Mar. PMID: 35285539 31. Tomasello U, Klingler E, Niquille M, et al. Cell Rep 2022 Feb. PMID: 35172154 32. Wei F, Uchihara T, Yonemura A, et al. FEBS J 2022 Dec. PMID: 36565059 33. Murthy PKL, Xi R, Arguijo D, et al. Dev Cell 2022 Feb. PMID: 35134344 34. Hirschberg S, Dvorzhak A, Rasooli-Nejad SMA et al. Front Cell Neurosci 2022 Jan. PMID: 35173582 35. Teijueiro LG. PhD Thesis, University Geneve, Switzerland, 2022 36. Amberg N and Hippenmeyer S. STAR Protoc 2021 Dec. PMID: 34825212 37. Shroff UN, Gyarmati G, Izuhara A, et al. Am J Physiol Renal Physiol 2021 Oct. PMID: 34693742 38. Gschwend J, Sherman SPM, Ridder F, et al. J Exp Med 2021 Oct. PMID: 34431978 39. Nowak N, Wood MB, Glowatzki E, et al. eNeuro 2021 Oct. PMID: 34607806 40. Huang X, Yan L, Kou S, et al. Transgenic Res 2021 Sep. PMID: 34542814 41. Bilal M, Nawaz A, Kado T, et al. Mol Metab 2021 Sep. PMID: 34562641 42. Hicks-Berthet J, Ning B, Federico A, et al. Cell Rep 2021 Jul. PMID: 34260916 43. Kirtay M, Sell J, Marx C, et al. Nat Commun 2021 Jul. PMID: 34210973 44. de Camargo LCB, Guaddachi F, Bergerat D, et al. Sci Rep 2020 Jun. PMID: 32488182 45. Medeiros de Lima JB, Debarba LK, Rupp AC, et al. Cells 2021 May. PMID: 34063647 46. Wang X, Shi H, Zhou J, et al. J Genet Genomics 2020 May. PMID: 32703661 47. Krenn V, Bosone C, Burkard TR, et al. Cell Stem Cell 2021 Apr. PMID: 33838105 48. Harris L, Rigo P, Stiehl T, et al. Cell Stem Cell 2021 Feb. PMID: 33581058 49. Li X, Liu G, Yang L, et al. Neuroscience Bulletin 2021 Feb. PMID: 33606177 50. Bottes S, Jaeger BN, Pilz GA, et al. Nat Neurosci 2021 Feb. PMID: 33349709 51. de Lara PT, Castañón H, Vermeer M, et al. Nat Commun 2021 Feb. PMID: 33536445 52. Nichols AEC, Miller SE, Green LJ, et al. bioRxiv 2021 53. Li Y, Ritchie EM, Steinke CL, et al. Elife 2021 Jan. PMID: 33475086 54. Chen KS, Lynton Z, Lim JWC, et al. Carcinogenesis 2020 Dec. PMID: 33346791 55. McClain JL, Mazzotta EA, Maradiaga N, et al. Am J Physiol Gastrointest Liver Physiol 2020 Dec. PMID: 32996781 56. Zhang KY , Tuffy C , Mertz JL, et al. Stem Cell Reports 2020 Dec. PMID: 33382979 57. Pinheiro T, Mayor I, Edwards S, et al. J Neurosci Methods 2020 Nov. PMID: 33217411 58. Best KT, Nichols AEC, Knapp E, et al. Sci Signal 2020 Nov. PMID: 33203721 59. Mansky B, PhD Thesis, University of California, San Francisco, USA, 2020 60. Edwards SJ, Carannante V, Kuhnigk K, et al. Front Mol Biosci 2020 Sep. PMID: 33195398 61. Xiong M, Tao Y, Gao Q, et al. Cell Stem Cell 2020 Sep. PMID: 32966778 62. Sada N, Fujita Y, Mizuta N, et al. Cell Death Dis 2020 Aug. PMID: 32811822 63. Aboualizadeh E, Phillips MJ, McGregor JE, et al. Stem Cell Reports 2020 Jul. PMID: 32707075 64. Laukoter S, Pauler FM, Beattie R, et al. Neuron 2020 Jul. PMID: 32707083 65. Muller PA, Schneeberger M, Matheis F, et al. Nature 2020 Jul. PMID: 32641826 66. Humbel M, Ramosaj M, Zimmer V, et al. Gene Ther 2020 Jul. PMID: 32632267 67. Hong SJ. PhD Thesis. UC San Francisco 2020 68. Thurner M, Deutsch M, Janke K, et al. Stem Cell Res Ther 2020 Jun. PMID: 32532320 69. de Camargo LCB, Guaddachi F, Bergerat D, et al. Sci Rep 2020 Jun.PMID: 32488182 70. Wang X, Shi H, Zhou J, et al. J Genet Genomics 2020 May. PMID: 32703661 71. Morral C, Stanisavljevic J, Hernando-Momblona X, et al. Cell Stem Cell 2020 May. PMID:32396863 72. Edwards TJ, Fenlon LR, Dean RJ, et al. NeuroImage 2020 Apr. PMID:32360691 73. Nomura K, Nakanishi M, Ishidate F, et al. Neuron 2020 Mar. PMID:32229307 74. Zhang Y, Liu G, Guo T, et al. Cell Rep Mar 2020. PMID: 32234482 75. Cadwell CR, Scala F, Fahey PG, et al. Elife 2020 Mar. PMID: 32134385 76. Kashiwagi M, Kanuka M, Tatsuzawa C, et al. Curr Biol 2020 Feb. PMID:32032507 77. Ruetten H, Wegner KA, Kennedy CL, et a. Am J Physiol Renal Physiol 2020 Jan. PMID:31904290 78. Best KT, Knapp E, Ketonis C, et al. bioRxiv 2020 79. Hirschberg S, Dvorzhak A, Rasooli-Nejad S, et al. bioRxiv 2020 80. Morcom L, Gobius I, Marsh A, et al. bioRxiv 2020 81. Stachniak T, Kastli R, Hanley O, et al. bioRxiv 2020 82. Frezel N, Platonova E, Voigt F, et al. bioRxiv 2020 83. de Lara P, Castañón H, Vermeer M, Núñez N, et al. bioRxiv 2020 84. Muller P, Schneeberger M, Matheis F, et al. bioRxiv 2020 85. Best K, Korcari A, Mora K, Knapp E, et al. bioRxiv 2020 86. Tran HN, Park W, Seong S, et al. Dev Dyn 2019 Dec. PMID:31872525 87. Stefanson O, MSc Thesis, Univ. of California - Santa Cruz, United States of America 2019 88. Monaco SA, PhD Thesis, Drexel University, United States of America 2019 89. Frezel N, PhD Thesis, Université Paris sciences et Lettres, France and Universität Zürich, Switzerland, 2019 90. Pan H, Fatima M, Li A, et al. Neuron 2019 Sep. PMID:31324538 91. Winnubst J, Bas E, Ferreira TA, et al. Cell 2019 Sep. PMID:31495573 92. Park H, Choi D, Park J, et al. Adv Sci 2019 Sep. PMID:31763149 93. Ruud J, Alber J, Tokarska A, et al. Cell Rep 2019 Jun. PMID:31189104 94. Andersen RE, Hong SJ, Lim JJ, et al. Dev Cell 2019 May. PMID:31112699 95. Pagani M, Albisetti GW, Sivakumar N, et al. Neuron 2019 May PMID:31103358 96. Ip CK, Zhang L, Farzi A, et al. Cell Metab 2019 Apr. PMID:31031093 97. Mathieu C, Ferren M, Jurgens E, et al. J Virol 2019 Apr. PMID:30728259 98. Tai Y, Gallo NB, Wang M, et al. Neuron 2019 Feb. PMID:30846310 99. Muller PA, Kerner Z, Pane MC, et al. bioRxiv 545806; Feb 2019. 100. Winnubst J, Bas E, Ferreira TA, et al. bioRxiv 537233; Feb 2019. 101. Albisetti GW, Pagani M, Platonova E, et al. J Neurosci 2019 Jan. PMID:30655357 102. Andersen RE, PhD Thesis, University of California, San Francisco, USA 2019 103. Blomfield IM, PhD Thesis, University College of London, United Kingdom, 2018 104. Smidler AL, Scott SN, Mameli E, et al. Parasit Vectors 2018 Dec. PMID:30583744 105. Ambrozkiewicz MC, Schwark M, Kishimoto-Suga M, et al. Neuron 2018 Oct. PMID:30392800 106. Zalucki O, Harris L, Harvey TJ, et al. Cereb Cortex 2018 Oct. PMID:30272140 107. Duan L, Zhang XD, Miao WY, et al. Neuron 2018 Sep. PMID:30269986 108. Blomfield IM, Rocamonde B, Masdeu MDM, et al. bioRxiv 426015; Sept 2018 109. Niquille M, Limoni G, Markopoulos F, et al. Elife 2018 Mar. PMID:29557780 110. Koba S, Hanai E, Kumada N, et al. J Physiol 2018 Jul. PMID:30019338 111. Coux RX, Teixeira FK, Lehmann R. Development 2018 Apr. PMID:29511022 112. Weider M, Starost LJ, Groll K, et al. Nat Commun 2018 Mar. PMID:29500351 113. Unnersjö-Jess D, Scott L, Sevilla SZ, et al. Kidney Int 2017 Dec. PMID:29241621 114. Ishibashi F, Shimizu H, Nakata T, et al. Stem Cell Report. 2017 Dec. PMID:29233556 115. Lacraz GPA, Junker JP, Gladka MM, et al. Circulation 2017 Oct. PMID:28724751 116. Paolino A, Fenlon LR, Kozulin P, et al. J Neurosci Methods 2017 Sep. PMID:28917658 117. Hurni N, Kolodziejczak M, Tomasello U, et al. Cereb Cortex 2017 May. PMID:28334356 118. Anzo M, Sekine S, Makihara S, et al. Genes Dev 2017 May. PMID:28637694 119. Beattie R, Postiglione MP, Burnett LE, et al. Neuron 2017 May. PMID:28472654
- Storage Conditions: For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.