Goat anti-tdTomato Polyclonal antibody

Goat anti-tdTomato Polyclonal antibody

• Description: Goat polyclonal antibody to tdTomato (red fluorescent protein) conjugated to DyLight® 650. tdTomato protein is derived from DsRed, an engineered red fluorescent protein from so-called disc corals of the genus Discosoma. It is a genetic fusion of two copies of the dTomato gene, which has been specifically designed for low aggregation. It´s brightness and emission wavelength, makes it ideal for live animal research.
• Specifications: In 293HEK cells transfected with cds plasmid detects a band of 55 kDa by Western blot. It also detects tdTomato in brain sections by IHC. This antibody is specific for tdTomato and mCherry proteins. It does not cross-react to GFP (green fluorescent protein).
• Product Name Alternative: Cherry fluorescent protein; DsRed, mCherry, red fluorescent protein, RFP antibody.
• CAS Number: 9007-83-4
• UNSPSC Description: Red Fluorescent Protein
• Volume: 100 µL
• Host: Goat
• Reactivity: Reacts against tdTomato, mCherry, red fluorescent protein (DsRed) from so-called disc corals of Discosoma species.
• Immunogen: Purified recombinant peptide produced in E. coli
• Target Antigen: Purified recombinant peptide produced in E. coli
• Immunogen Type: Recombinant protein
• Target: Anti-tdTomato, DyLight®650
• Clonality: Polyclonal
• Isotype: IgG
• Conjugation: DyLight®650
• Type: Primary
• Sequence: MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
• Applications: WB, IF, IHC-F
• Purification: Epitope affinity purified
• Concentration: 2.5 mg/mL
• Dilution: WB:1:500-1:2,000, IF:1:50-1:500, IHC-F:1:50-1:1,000
• Form: Polyclonal antibody supplied as a 100 µl (2.5 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
• Buffer: PBS, 20% glycerol and 0.05% sodium azide
• Storage Conditions: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.