Goat anti-tdTomato Polyclonal antibody
CAT:
894-AB181650-100
Size:
250 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Goat anti-tdTomato Polyclonal antibody
- Description: Goat polyclonal antibody to tdTomato (red fluorescent protein) conjugated to DyLight® 650. tdTomato protein is derived from DsRed, an engineered red fluorescent protein from so-called disc corals of the genus Discosoma. It is a genetic fusion of two copies of the dTomato gene, which has been specifically designed for low aggregation. It´s brightness and emission wavelength, makes it ideal for live animal research.
- Specifications: In 293HEK cells transfected with cds plasmid detects a band of 55 kDa by Western blot. It also detects tdTomato in brain sections by IHC. This antibody is specific for tdTomato and mCherry proteins. It does not cross-react to GFP (green fluorescent protein).
- Alternative Name: Cherry fluorescent protein; DsRed, mCherry, red fluorescent protein, RFP antibody.
- UNSPSC Description: Red Fluorescent Protein
- Volume: 100 µL
- Host: Goat
- Reactivity: Reacts against tdTomato, mCherry, red fluorescent protein (DsRed) from so-called disc corals of Discosoma species.
- Immunogen: Purified recombinant peptide produced in E. coli
- Target Antigen: Purified recombinant peptide produced in E. coli
- Immunogen Type: Recombinant protein
- Target: Anti-tdTomato, DyLight®650
- Clonality: Polyclonal
- Isotype: IgG
- Conjugation: DyLight®650
- Type: Primary
- Sequence: MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
- Applications: WB, IF, IHC-F
- Purification: Epitope affinity purified
- Concentration: 2.5 mg/mL
- Dilution: WB:1:500-1:2,000, IF:1:50-1:500, IHC-F:1:50-1:1,000
- Form: Polyclonal antibody supplied as a 100 µl (2.5 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
- Buffer: PBS, 20% glycerol and 0.05% sodium azide
- Storage Conditions: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.