Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A)
CAT:
399-CSB-EP757211GU-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A)
- CAS Number: 9000-83-3
- Gene Name: IL23A
- UniProt: Q6LA37
- Expression Region: 20-189aa
- Organism: Cavia porcellus
- Target Sequence: RAVSGSSNPSWTQCQQLSQKLCTLAWSAHPSVGHVEPPREEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLGSDIFTGEPPLFPDGPVSQLHASLLGLSQLLQPEVHQWEPQIPSLSPNQPWQRLLLRIKILRSFQAFVAVAARVFGHGAATLTP
- Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
- Source: E.coli
- Field of Research: Cancer
- Assay Type: In Stock Protein
- Relevance: Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length of Mature Protein
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 26.2 kDa
- References & Citations: "Molecular cloning and functional characterization of guinea pig interleukin-23." Shiratori I., Seya T. Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.