Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A)

Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A)

• CAS Number: 9000-83-3
• Gene Name: IL23A
• UniProt: Q6LA37
• Expression Region: 20-189aa
• Organism: Cavia porcellus
• Target Sequence: RAVSGSSNPSWTQCQQLSQKLCTLAWSAHPSVGHVEPPREEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLGSDIFTGEPPLFPDGPVSQLHASLLGLSQLLQPEVHQWEPQIPSLSPNQPWQRLLLRIKILRSFQAFVAVAARVFGHGAATLTP
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Source: E.coli
• Field of Research: Cancer
• Assay Type: In Stock Protein
• Relevance: Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Full Length of Mature Protein
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 26.2 kDa
• References & Citations: "Molecular cloning and functional characterization of guinea pig interleukin-23." Shiratori I., Seya T. Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.