S100A15A, Mouse (solution)

• Description :

  The S100A15A protein is part of the Tyr protein kinase family in the ROR subfamily and is related to phosphorylation events, especially phosphorylation events on tyrosine residues. Its association with the receptor tyrosine kinase-like orphan receptor (ROR) family suggests its potential role in cell signaling pathways, affecting processes such as cell growth and differentiation. S100A15A Protein, Mouse (solution) is the recombinant mouse-derived S100A15A protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  S100A15A Protein, Mouse (solution), Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/s100a15a-protein-mouse-solution.html

• Purity :

  98.0

• Smiles :

  MPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTEHSLY

• Molecular Formula :

  381493 (Gene_ID) Q6S5I3 (M1-Y108) (Accession)

• Molecular Weight :

  Approximately 12.0 kDa.

• Shipping Conditions :

  Dry ice.

• Storage Conditions :

  Stored at -80°C for 1 year

• Scientific Category :

  Recombinant Proteins