IL-18, Mouse (solution)

• Description :

  IL-18 protein is a pro-inflammatory cytokine that plays an important role in epithelial barrier repair and immune response regulation by polarizing T helper 1 (Th1) cells and natural killer (NK) cells. After binding to IL18R1 and IL18RAP receptors, IL-18 forms a signaling ternary complex, activates NF-κ-B, and induces inflammatory mediators. IL-18 Protein, Mouse (solution) is the recombinant mouse-derived IL-18 protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  IL-18 Protein, Mouse (solution), Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/il-18-protein-mouse.html

• Purity :

  98.00

• Smiles :

  NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

• Molecular Formula :

  16173 (Gene_ID) P70380 (N36-S192) (Accession)

• Molecular Weight :

  Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Dry ice

• Storage Conditions :

  Stored at -80°C for 1 year

• Scientific Category :

  Recombinant Proteins