Recombinant Staphylococcus aureus Clumping factor A (clfA), partial

• Description :

  Recombinant Staphylococcus aureus Clumping factor A (clfA), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain MSSA476) . Target Name: clfA. Target Synonyms: Fibrinogen receptor AFibrinogen-binding protein A. Accession Number: Q6GB45. Expression Region: 228~558aa. Tag Info: Tag-Free. Theoretical MW: 36.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description :

  Recombinant Staphylococcus aureus Clumping factor A (clfA), partial is a purified Recombinant Protein.

• Accession Number :

  Q6GB45

• Expression Region :

  228~558aa

• Host :

  E. coli

• Target :

  ClfA

• Conjugation :

  Unconjugated

• Tag :

  Tag-Free

• Field of Research :

  Microbiology

• Endotoxin :

  Not Tested

• Purity :

  >90% by SDS-PAGE

• Activity :

  Not Tested

• Length :

  Partial

• Buffer :

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution :

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight :

  36.1kDa

• Shipping Conditions :

  Ice packs

• Storage Conditions :

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name :

  Fibrinogen receptor AFibrinogen-binding protein A

• Species :

  Staphylococcus aureus (strain MSSA476)

• Protein Name :

  Recombinant Protein

• CAS Number :

  9000-83-3

• AA Sequence :

  GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE