Recombinant Mouse Complement C1q subcomponent subunit A (C1qa)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Mouse Complement C1q subcomponent subunit A (C1qa)
Description :
Recombinant Mouse Complement C1q subcomponent subunit A (C1qa) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: C1qa. Target Synonyms: C1qaComplement C1q subcomponent subunit A. Accession Number: P98086. Expression Region: 23~245aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 29.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.Short Description :
Recombinant Mouse Complement C1q subcomponent subunit A (C1qa) is a purified Recombinant Protein.Accession Number :
P98086Expression Region :
23~245aaHost :
E. coliTarget :
C1qaConjugation :
UnconjugatedTag :
N-Terminal 6Xhis-TaggedField of Research :
ImmunologyEndotoxin :
Not TestedPurity :
>85% by SDS-PAGEActivity :
Not TestedLength :
Full Length of Mature ProteinBuffer :
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.Reconstitution :
Refer to the datasheet/CoA included in the product pouch.Molecular Weight :
29.1kDaShipping Conditions :
Ice packsStorage Conditions :
-20°C. Avoid repeated freeze/thaw cycles.Target Alternative Name :
C1qaComplement C1q subcomponent subunit ASpecies :
Mouse (Mus musculus)Protein Name :
Recombinant ProteinCAS Number :
9000-83-3AA Sequence :
EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

