Recombinant Mouse Complement C1q subcomponent subunit A (C1qa)

CAT:
617-RPC20998-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Complement C1q subcomponent subunit A (C1qa) - image 1

Recombinant Mouse Complement C1q subcomponent subunit A (C1qa)

  • Description:

    Recombinant Mouse Complement C1q subcomponent subunit A (C1qa) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: C1qa. Target Synonyms: C1qaComplement C1q subcomponent subunit A. Accession Number: P98086. Expression Region: 23~245aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 29.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
  • Short Description:

    Recombinant Mouse Complement C1q subcomponent subunit A (C1qa) is a purified Recombinant Protein.
  • Accession Number:

    P98086
  • Expression Region:

    23~245aa
  • Host:

    E. coli
  • Target:

    C1qa
  • Conjugation:

    Unconjugated
  • Tag:

    N-Terminal 6Xhis-Tagged
  • Field of Research:

    Immunology
  • Endotoxin:

    Not Tested
  • Purity:

    >85% by SDS-PAGE
  • Activity:

    Not Tested
  • Length:

    Full Length of Mature Protein
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    Refer to the datasheet/CoA included in the product pouch.
  • Molecular Weight:

    29.1kDa
  • Shipping Conditions:

    Ice packs
  • Storage Conditions:

    -20°C. Avoid repeated freeze/thaw cycles.
  • Target Alternative Name:

    C1qaComplement C1q subcomponent subunit A
  • Species:

    Mouse (Mus musculus)
  • Protein Name:

    Recombinant Protein
  • CAS Number:

    9000-83-3
  • AA Sequence:

    EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA