Recombinant Human Complement C1q subcomponent subunit A (C1QA)

• Description :

  Recombinant Human Complement C1q subcomponent subunit A (C1QA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Complement C1q subcomponent subunit A (C1QA) . Accession Number: P02745; C1QA. Expression Region: 23-245aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 39.7kda. Target Synonyms: C1qa; C1QA_HUMAN; Complement C1q subcomponent subunit A; Complement component 1 q subcomponent A chain; Complement component 1 q subcomponent alpha polypeptide; Complement component C1q A chain Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description :

  Recombinant Human Complement C1q subcomponent subunit A (C1QA) is a purified Recombinant Protein.

• Accession Number :

  P02745; C1QA

• Expression Region :

  23-245aa

• Host :

  E. coli

• Target :

  Complement C1q subcomponent subunit A (C1QA)

• Conjugation :

  Unconjugated

• Tag :

  N-Terminal 6xHis-SUMO-Tagged

• Field of Research :

  Immunology

• Endotoxin :

  Not Tested

• Purity :

  >90% by SDS-PAGE

• Activity :

  Not Tested

• Length :

  Full Length of Mature Protein

• Reconstitution :

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight :

  39.7kDa

• Shipping Conditions :

  Ice packs

• Storage Conditions :

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name :

  C1qa; C1QA_HUMAN; Complement C1q subcomponent subunit A; Complement component 1 q subcomponent A chain; Complement component 1 q subcomponent alpha polypeptide; Complement component C1q A chain

• Species :

  Human (Homo sapiens)

• Protein Name :

  Recombinant Protein

• AA Sequence :

  EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA