Recombinant Rat Complement factor D (Cfd)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Rat Complement factor D (Cfd)
Description:
Recombinant Rat Complement factor D (Cfd) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Cfd. Target Synonyms: AdipsinC3 convertase activatorEndogenous vascular elastaseProperdin factor D. Accession Number: P32038. Expression Region: 26~263aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 29.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.Short Description:
Recombinant Rat Complement factor D (Cfd) is a purified Recombinant Protein.Accession Number:
P32038Expression Region:
26~263aaHost:
Mammalian CellsTarget:
CfdConjugation:
UnconjugatedTag:
N-Terminal 10Xhis-Tagged And C-Terminal Myc-TaggedField of Research:
ImmunologyEndotoxin:
Not TestedPurity:
>90% by SDS-PAGEActivity:
Not TestedLength:
Full Length of Mature ProteinBuffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.Reconstitution:
Refer to the datasheet/CoA included in the product pouch.Molecular Weight:
29.8kDaShipping Conditions:
Ice packsStorage Conditions:
-20°C. Avoid repeated freeze/thaw cycles.Target Alternative Name:
AdipsinC3 convertase activatorEndogenous vascular elastaseProperdin factor DSpecies:
Rat (Rattus norvegicus)Protein Name:
Recombinant ProteinCAS Number:
9000-83-3AA Sequence:
ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA
