Recombinant Human Alpha-synuclein (SNCA)

• Description:

  Recombinant Human Alpha-synuclein (SNCA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SNCA. Target Synonyms: Non-A beta component of AD amyloidNon-A4 component of amyloid precursor; NACP. Accession Number: P37840. Expression Region: 1~140aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description:

  Recombinant Human Alpha-synuclein (SNCA) is a purified Recombinant Protein.

• Accession Number:

  P37840

• Expression Region:

  1~140aa

• Host:

  Yeast

• Target:

  SNCA

• Conjugation:

  Unconjugated

• Tag:

  N-Terminal 6Xhis-Tagged

• Field of Research:

  Neuroscience

• Endotoxin:

  Not Tested

• Purity:

  >90% by SDS-PAGE

• Activity:

  Not Tested

• Length:

  Full Length

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight:

  16.5kDa

• Shipping Conditions:

  Ice packs

• Storage Conditions:

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name:

  Non-A beta component of AD amyloidNon-A4 component of amyloid precursor; NACP

• Species:

  Human (Homo sapiens)

• Protein Name:

  Recombinant Protein

• CAS Number:

  9000-83-3

• AA Sequence:

  MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA