Recombinant Rat Alpha-synuclein (Snca)

• Description:

  Recombinant Rat Alpha-synuclein (Snca) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Snca. Target Synonyms: Snca; Alpha-synuclein. Accession Number: P37377. Expression Region: 1~140aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 41.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description:

  Recombinant Rat Alpha-synuclein (Snca) is a purified Recombinant Protein.

• Accession Number:

  P37377

• Expression Region:

  1~140aa

• Host:

  E. coli

• Target:

  Snca

• Conjugation:

  Unconjugated

• Tag:

  N-Terminal Gst-Tagged

• Endotoxin:

  Not Tested

• Purity:

  >90% by SDS-PAGE

• Activity:

  Not Tested

• Length:

  Full Length

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight:

  41.5kDa

• Shipping Conditions:

  Ice packs

• Storage Conditions:

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name:

  Snca; Alpha-synuclein

• Species:

  Rat (Rattus norvegicus)

• Protein Name:

  Recombinant Protein

• CAS Number:

  9000-83-3

• AA Sequence:

  MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA