Recombinant Human Trypsin-3 (PRSS3), partial
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Human Trypsin-3 (PRSS3), partial
Description :
Recombinant Human Trypsin-3 (PRSS3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PRSS3. Target Synonyms: Brain trypsinogen; Mesotrypsinogen; Serine protease 3Serine protease 4Trypsin IIITrypsin IV. Accession Number: P35030. Expression Region: 81~303aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.CAS Number :
9000-83-3Short Description :
Recombinant Human Trypsin-3 (PRSS3), partial is a purified Recombinant Protein.Accession Number :
P35030Expression Region :
81~303aaHost :
E. coliTarget :
PRSS3Conjugation :
UnconjugatedTag :
N-Terminal 6Xhis-TaggedField of Research :
Signal TransductionEndotoxin :
Not TestedPurity :
>90% by SDS-PAGEActivity :
Not TestedLength :
PartialBuffer :
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.Reconstitution :
Refer to the datasheet/CoA included in the product pouch.Molecular Weight :
28.2kDaShipping Conditions :
Ice packsStorage Conditions :
-20°C. Avoid repeated freeze/thaw cycles.Target Alternative Name :
Brain trypsinogen; Mesotrypsinogen; Serine protease 3Serine protease 4Trypsin IIITrypsin IVSpecies :
Human (Homo sapiens)Protein Name :
Recombinant ProteinAA Sequence :
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN

