Recombinant Rat Sortilin (Sort1), partial

• Description:

  Recombinant Rat Sortilin (Sort1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Sort1. Target Synonyms: Glycoprotein 110; Gp110Neurotensin receptor 3; NTR3. Accession Number: O54861. Expression Region: 610~754aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description:

  Recombinant Rat Sortilin (Sort1), partial is a purified Recombinant Protein.

• Accession Number:

  O54861

• Expression Region:

  610~754aa

• Host:

  E. coli

• Target:

  Sort1

• Conjugation:

  Unconjugated

• Tag:

  N-Terminal 6Xhis-Sumo-Tagged

• Endotoxin:

  Not Tested

• Purity:

  >90% by SDS-PAGE

• Activity:

  Not Tested

• Length:

  Partial

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight:

  32.5kDa

• Shipping Conditions:

  Ice packs

• Storage Conditions:

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name:

  Glycoprotein 110; Gp110Neurotensin receptor 3; NTR3

• Species:

  Rat (Rattus norvegicus)

• Protein Name:

  Recombinant Protein

• CAS Number:

  9000-83-3

• AA Sequence:

  CEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAREVKDLKKKCTSNFLNPKKQNSKSSS