EMAP-II, Human

CAT: 0804-HY-P7156Size: InquireDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P7156Size:Inquire

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

UNSPSC Description

EMAP-II Protein, Human is a proinflammatory cytokine and chemoattractant of macrophages.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/emap-ii-protein-human.html

Smiles

SKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK

Molecular Weight

Approximately 18.2 kDa

References & Citations

[1]Schluesener HJ, et al. Localization of endothelial-monocyte-activating polypeptide II (EMAP II), a novel proinflammatory cytokine, to lesions of experimental autoimmune encephalomyelitis, neuritis and uveitis: expression by monocytes and activated microglial cells. Glia. 1997 Aug;20(4):365-72.|[2]Barnett G, et al. Prostate adenocarcinoma cells release the novel proinflammatory polypeptide EMAP-II in response to stress. Cancer Res. 2000 Jun 1;60(11):2850-7.

Shipping Conditions

Room temperature

Related Products

Catalog	Name
HY-P77643-01	EMAP-II, Mouse (His)
HY-P83018-01	EMAP II Antibody (YA2763, Rabbit)
HY-P1752-01	Urocortin II, human
HY-13948-01	Angiotensin II human
HY-P1752B-01	Urocortin II, human (acetate)
HY-13948B-01	Angiotensin II human (TFA)
HY-13948A-01	Angiotensin II human (acetate)
HY-P1168	[Orn8]-Urotensin II (human)
HY-P1752A	Urocortin II, human (TFA)
HY-E70038	Endoglycoceramidase II (EGCase II)

Alternative Products

Catalog	Name
HC88857	Human EMAP II
OM297442-01	EMAP II Human
MBS691647-01	Human EMAP-II
P5381-100μg	Recombinant Human EMAP-II
B2010351	EMAP-II (Human, Recombinant)
GTR19008975	Human EMAP II protein
90123-A	Human EMAP-II Recombinant
RHF902	Anti-Human EMAP II
4463-20	EMAP II, human recombinant
Z05236-500	EMAP-II/AIMP1, His, Human

EMAP-II, Human

Related Products

Alternative Products

Popular Products