ITPase, Human (His)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: Yes


ITPase, Human (His)
Description:
ITPase protein is a pyrophosphatase that is essential in nucleotide metabolism and can hydrolyze non-classical purine nucleotides such as ITP, dITP, dHAPTP and XTP into their respective monophosphate derivatives. It lacks distinction between deoxy and ribose forms. ITPase Protein, Human (His) is the recombinant human-derived ITPase protein, expressed by E. coli , with C-6*His labeled tag.Product Name Alternative:
ITPase Protein, Human (His), Human, E. coliUNSPSC:
12352202Type:
Recombinant ProteinsAssay Protocol:
https://www.medchemexpress.com/cytokines/itpase-protein-human-his.htmlSmiles:
AASLVGKKIVFVTGNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLAAMolecular Formula:
3704 (Gene_ID) Q9BY32-1 (A2-A194) (Accession)Molecular Weight:
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.Shipping Conditions:
Dry ice.Scientific Category:
Recombinant Proteins
