Products for Research Use Only
RegisterLogin

SCGN, Human (His)

CAT: 0804-HY-P76050-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P76050-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
SCGN Protein is a calcium-sensor protein with a regulatory role in glucose metabolism and the secretion of several peptide hormones. Secretagogin (SCGN) is a three-domain hexa-EF-hand Ca2+-binding protein. SCGN is a Ca2+-dependent generic molecular chaperone involved in protein homeostasis with broad substrate specificity. The overexpression of SCGN efficiently prevents cells from heat shock and oxidative damage. SCGN enhances pancreatic insulin secretion and is a useful biomarker of endocrine tumors, stroke, and psychiatric conditions[1][2][3]. SCGN Protein, Human (His) is the recombinant human-derived SCGN protein, expressed by E. coli , with N-His labeled tag.
Product Name Alternative
SCGN Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/scgn-protein-human-his.html
Purity
98.0
Smiles
DSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
Molecular Formula
10590 (Gene_ID) O76038 (D2-P276) (Accession)
Molecular Weight
Approximately 34 kDa
References & Citations
[1]Yunlong Dong, et al. Secretagogin, a marker for neuroendocrine cells, is more sensitive and specific in large cell neuroendocrine carcinoma compared with the markers CD56, CgA, Syn and Napsin A. Oncol Lett. 2020 Mar;19 (3) :2223-2230.|[2]Radhika Khandelwal, et al. Extracellular secretagogin is internalized into the cells through endocytosis. FEBS J. 2022 Jun;289 (11) :3183-3204.|[3]Amrutha H Chidananda, et al. Secretagogin is a Ca2+-dependent stress-responsive chaperone that may also play a role in aggregation-based proteinopathies. J Biol Chem. 2022 Sep;298 (9) :102285.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P71042SCGN, Human (HEK293, His)
HY-RS12509SCGN Human Pre-designed siRNA Set A
HY-P81422-01SCGN Antibody (YA1167, Rabbit)
HY-RS19641Scgn Mouse Pre-designed siRNA Set A
HY-RS26134Scgn Rat Pre-designed siRNA Set A
HY-P71279-01SCG3/Secretogranin-3, Human (HEK293, His)
HY-P74568-01SCG3/Secretogranin-3, Human (HEK293, His, solution)
HY-P703697-01CLEC11A/SCGF-alpha, Rat (HEK293, His)
HY-P700824SCG3/Secretogranin-3, Cynomolgus (HEK293, His)
HY-P78352SCG3/Secretogranin-3, Mouse (HEK293, His)

Alternative Products

CatalogName
ARO-P14249-01Recombinant Human SCGN, N-His
P528274SCGN Protein (N-His, Human)
E40KMPH6549Human SCGN Protein, His Tag
TMPY-01875-01SCGN Protein, Human, Recombinant (His)
055361-01Secretagogin (SCGN), Recombinant, Human, His-Tag
32-11009-500Recombinant Human Secretagogin/SCGN (C-His)
GTR19142362-01Recombinant Human SCGN Protein, N-His
P518162SCGN/Secretagogin Protein (N-His, Human)
PH52363E1SCGN Protein, Human, Recombinant (His Tag)
KMP1282Recombinant Human SCGN Protein, His Tag

Popular Products