Recombinant Human CD70 antigen (CD70) , partial
CAT:
399-CSB-MP004954HUc9-01
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Human CD70 antigen (CD70) , partial
- CAS Number: 9000-83-3
- Gene Name: CD70
- UniProt: P32970
- Expression Region: 39-193aa
- Organism: Homo sapiens
- Target Sequence: QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
- Tag: N-terminal hFc-tagged
- Source: Mammalian cell
- Field of Research: Cancer
- Assay Type: Developed Protein
- Relevance: Cytokine which is the ligand for CD27. The CD70-CD27 pathway plays an important role in the generation and maintenance of T cell immunity, in particular during antiviral responses. Upon CD27 binding, induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 67.8 kDa
- References & Citations: Molecular and biological characterization of a ligand for CD27 defines a new family of cytokines with homology to tumor necrosis factor.Goodwin R.G., Alderson M.R., Smith C.A., Armitage R.J., Vandenbos T., Jerzy R., Tough T.W., Schoenborn M.A., David-Smith T., Hennen K., Falk B., Cosman D., Baker E., Sutherland G.R., Grabstein K.H., Farrah T., Giri J.G., Beckmann M.P.Cell 73:447-456 (1993)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Protein Length: Partial