Recombinant Human CD70 antigen (CD70) , partial (Active)
CAT:
399-CSB-MP004954HU1-03
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No








Recombinant Human CD70 antigen (CD70) , partial (Active)
- CAS Number: 9000-83-3
- Gene Name: CD70
- UniProt: P32970
- Expression Region: 52-193aa
- Organism: Homo sapiens
- Target Sequence: SLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
- Tag: N-terminal 10xHis-tagged
- Source: Mammalian cell
- Field of Research: Cancer
- Assay Type: Active Protein & In Stock Protein
- Relevance: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a role in the morphological organization of liver and intestine. Involved in intestinal peptide transport.
- Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: ①Measured by its binding ability in a functional ELISA. Immobilized Human CD70 at 2 μg/mL can bind Anti-CD70 antibody, the EC50 is 2.414-3.196 ng/mL.
- Length: Partial
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 22.7 kDa
- References & Citations: "A clinicopathological study on the expression of cadherin-17 and caudal-related homeobox transcription factor (CDX2) in human gastric carcinoma." Ge J., Chen Z., Wu S., Yuan W., Hu B., Chen Z. Clin Oncol (R Coll Radiol) 20:275-283 (2008)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Protein Length: Partial