EEF1B2, Human (His)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


EEF1B2, Human (His)
Description :
EEF1B2 Protein facilitates GDP-to-GTP exchange on EEF1A Protein, driving the conversion. EEF1 comprises four subunits: alpha, beta, delta, and gamma. EEF1B2 Protein, Human (His) is the recombinant human-derived EEF1B2 protein, expressed by E. coli , with N-6*His labeled tag.Product Name Alternative :
EEF1B2 Protein, Human (His), Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/eef1b2-protein-human-his.htmlPurity :
94.20Smiles :
GFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKIMolecular Formula :
1933 (Gene_ID) P24534 (G2-I225) (Accession)Molecular Weight :
Approximately 29 kDaShipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

