Products for Research Use Only
RegisterLogin

Profilin-2, Human

CAT: 0804-HY-P71237Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71237Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Profilin-2 protein is a key player in protein folding. It specifically binds to cytosolic chaperone protein (c-CPN) and promotes the transfer of target proteins. It also interacts with nascent polypeptide chains, helping unnatural proteins fold correctly in various competing pathways. Profilin-2 Protein, Human is the recombinant human-derived Profilin-2 protein, expressed by E. coli , with tag free.
Product Name Alternative
Profilin-2 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/profilin-2-protein-human.html
Smiles
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Molecular Formula
5217 (Gene_ID) P35080-1 (M1-F140) (Accession)
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P73697-01Profilin-4, Human (His)
HY-P82051-01Profilin 1 Antibody (YA1796, Rabbit)
HY-P4815Prokineticin 2 Isoform 2 (human)
HY-P88244PROM2 (Prominin 2) Antibody (YA7928, Mouse)
HY-P71177-01Nucleobindin-2, Human
HY-147931Human enteropeptidase-IN-2
HY-P2313Human β-defensin-2
HY-P7037-01IL-2, Human
HY-P7135-01BD-2, Human
HY-P7653-01Bcl-2-like 2, Human (His)

Alternative Products

CatalogName
P9005-89WProfilin 2, Recombinant, Human (Profilin-2, Profilin II, Profilin-II, PFN2, PFN-2, D3S1319E, PFL)
MBS636484-01Profilin 2a (PFN2, Profilin-2) Recombinant, Human
MBS144032-01Recombinant Human Profilin-2
MBS7609792-01Recombinant Human Profilin 2
rAP-4574Profilin-2 Human Recombinant
GTR18887549-01Human Profilin 2 protein
P9005-90Profilin 2a (PFN2, Profilin-2) Recombinant, Human discontinued
156453-01Profilin 2 (PFN2) Recombinant, Human
abx068677-01Human Profilin 2 (PFN2) Protein
AP75888-01Recombinant Human Profilin-2/PFN2

Popular Products