SCP2, Human (GST)

CAT: 0804-HY-P704001Size: 1 EachDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P704001Size:1 Each

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

SCP2 Protein, Human (GST) is the recombinant human-derived SCP2 protein, expressed by E. coli, with N-GST tag.

Product Name Alternative

SCP2 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/scp2-protein-human-gst.html

Smiles

MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

Molecular Formula

6342 (Gene_ID) P22307-2 (M1-L143) (Accession)

Molecular Weight

Approximately 42.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
HY-RS12559	SCP2 Human Pre-designed siRNA Set A
HY-RS27331	Scp2 Rat Pre-designed siRNA Set A
HY-RS20817	Scp2 Mouse Pre-designed siRNA Set A
HY-P71401-01	UBE2G2, Human (GST)
HY-P701932	ADH6, Human (GST)
HY-P705432	IL1B, Human (GST)
HY-P704096	VAV1, Human (GST)
HY-P704074	CHMP1B, Human (GST)
HY-P71683	RPS13, Human (GST)
HY-P701927	ADH4, Human (GST)

Catalog	Name
TMPH-01780-01	SCP2 Protein, Human, Recombinant (GST)
375224-01	SCP2, Recombinant, Human, aa1-143, GST-Tag (Non-specific Lipid-transfer Protein)
MBS7615793-01	Recombinant Human SCP2
MBS8218442-01	SCP2 siRNA (Human)
43198051	SCP2 Adenovirus (Human)
GTR18918160-01	Human SCP2 protein
abx904812-01	Human SCP2 siRNA
P92631	PCMV-SCP2 (human) -Neo
MBS8419126-01	Human SCP2 Protein Lysate
abx954277-01	Human SCP2 shRNA Plasmid