Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A) , partial

• CAS Number:

  9000-83-3

• Gene Name:

  SCN1A

• UniProt:

  P35498

• Expression Region:

  1-128aa

• Organism:

  Homo sapiens

• Target Sequence:

  MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Source:

  Baculovirus

• Field of Research:

  Others

• Assay Type:

  Developed Protein

• Relevance:

  Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na+ ions may pass in accordance with their electrochemical gradient. Plays a key role in brain, probably by regulating the moment when neurotransmitters are released in neurons. Involved in sensory perception of mechanical pain: activation in somatosensory neurons induces pain without neurogenic inflammation and produces hypersensitivity to mechanical, but not thermal stimuli.

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Length:

  Partial

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  18.3 kDa

• References & Citations:

  "The tarantula toxin beta/delta-TRTX-Pre1a highlights the importance of the S1-S2 voltage-sensor region for sodium channel subtype selectivity." Wingerd J.S., Mozar C.A., Ussing C.A., Murali S.S., Chin Y.K., Cristofori-Armstrong B., Durek T., Gilchrist J., Vaughan C.W., Bosmans F., Adams D.J., Lewis R.J., Alewood P.F., Mobli M., Christie M.J., Rash L.D. Sci. Rep. 7:974-988 (2017)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.