Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A) , partial

Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A) , partial

• CAS Number: 9000-83-3
• Gene Name: SCN1A
• UniProt: P35498
• Expression Region: 1-128aa
• Organism: Homo sapiens
• Target Sequence: MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Source: Baculovirus
• Field of Research: Others
• Assay Type: Developed Protein
• Relevance: Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na+ ions may pass in accordance with their electrochemical gradient. Plays a key role in brain, probably by regulating the moment when neurotransmitters are released in neurons. Involved in sensory perception of mechanical pain: activation in somatosensory neurons induces pain without neurogenic inflammation and produces hypersensitivity to mechanical, but not thermal stimuli.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Partial
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 18.3 kDa
• References & Citations: "The tarantula toxin beta/delta-TRTX-Pre1a highlights the importance of the S1-S2 voltage-sensor region for sodium channel subtype selectivity." Wingerd J.S., Mozar C.A., Ussing C.A., Murali S.S., Chin Y.K., Cristofori-Armstrong B., Durek T., Gilchrist J., Vaughan C.W., Bosmans F., Adams D.J., Lewis R.J., Alewood P.F., Mobli M., Christie M.J., Rash L.D. Sci. Rep. 7:974-988 (2017)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.