NFYA, Human

• Description :

  The NFYA protein is a component of the NF-Y transcription factor and recognizes the 5'-CCAAT-3' box motif in gene promoters. NFYA functions as an activator or repressor depending on the interacting cofactors. NFYA Protein, Human is the recombinant human-derived NFYA protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  NFYA Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/nfya-protein-human.html

• Smiles :

  MEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS

• Molecular Formula :

  4800 (Gene_ID) P23511-2 (M1-S318) (Accession)

• Molecular Weight :

  Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Scientific Category :

  Recombinant Proteins