Recombinant Human Tissue factor (F3) , partial
CAT:
399-CSB-MP007928HU-WD-01
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

Recombinant Human Tissue factor (F3) , partial
- CAS Number: 9000-83-3
- Gene Name: Tissue Factor
- UniProt: P13726
- Expression Region: 33-251aa
- Organism: Homo sapiens
- Target Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
- Tag: Tag free
- Source: Mammalian cell
- Field of Research: Others
- Assay Type: In Stock Protein
- Endotoxin: < 1 EU/mg as determined by LAL test.
- Purity: Greater than 95% as determined by SDS-PAGE.
- Activity: Not test
- Length: Partial
- Form: Lyophilized powder
- Buffer: Lyophilized from 0.22 μm filtered solution in PBS,5%mannital,0.01% Tween80 pH7.4.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 24.8 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.