Recombinant Human Tissue factor (F3) , partial

CAT:
399-CSB-MP007928HU-WD-03
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Tissue factor (F3) , partial - image 1

Recombinant Human Tissue factor (F3) , partial

  • Gene Name:

    Tissue Factor
  • UniProt:

    P13726
  • Expression Region:

    33-251aa
  • Organism:

    Homo sapiens
  • Target Sequence:

    SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
  • Tag:

    Tag free
  • Source:

    Mammalian cell
  • Field of Research:

    Others
  • Assay Type:

    In Stock Protein
  • Endotoxin:

    < 1 EU/mg as determined by LAL test.
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Not test
  • Length:

    Partial
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from 0.22 μm filtered solution in PBS,5%mannital,0.01% Tween80 pH7.4.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    24.8 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3