Recombinant Human Tissue factor (F3) , partial

Recombinant Human Tissue factor (F3) , partial

• CAS Number: 9000-83-3
• Gene Name: Tissue Factor
• UniProt: P13726
• Expression Region: 33-251aa
• Organism: Homo sapiens
• Target Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
• Tag: Tag free
• Source: Mammalian cell
• Field of Research: Others
• Assay Type: In Stock Protein
• Endotoxin: ＜ 1 EU/mg as determined by LAL test.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Activity: Not test
• Length: Partial
• Form: Lyophilized powder
• Buffer: Lyophilized from 0.22 μm filtered solution in PBS，5%mannital，0.01% Tween80 pH7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 24.8 kDa
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.