Recombinant Pig Sialoadhesin (SIGLEC1) , partial
CAT:
399-CSB-EP021293PI-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Pig Sialoadhesin (SIGLEC1) , partial
- CAS Number: 9000-83-3
- Gene Name: SIGLEC1
- UniProt: A7LCJ3
- Expression Region: 20-153aa
- Organism: Sus scrofa
- Target Sequence: SWTVSRPETVQGIKGSCLIIPCTFGFPANVEVPHGITAIWYYDYSGKRLVVSHSRNPKVVENHFQGRALLLGQAEQRTCSLLLKDLQPQDSGSYNFRFEISEGNRWSDVKGTVVTVTEVPSVPTIALPAKLHEG
- Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
- Source: E.coli
- Field of Research: Immunology
- Assay Type: In Stock Protein
- Relevance: Macrophage-restricted adhesion molecule that mediates sialic-acid dependent binding to lymphocytes, including granulocytes, monocytes, natural killer cells, B-cells and CD8 T-cells. Preferentially binds to alpha-2, 3-linked sialic acid. Binds to SPN/CD43 on T-cells. May play a role in hemopoiesis (By similarity). Acts as an endocytic receptor mediating clathrin dependent endocytosis. In case of porcine reproductive and respiratory syndrome virus (PRRSV), mediates virion attachment and internalization into alveolar macrophages through a clathrin-coated dependent process.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 22.3 kDa
- References & Citations: "Porcine arterivirus attachment to the macrophage-specific receptor sialoadhesin is dependent on the sialic acid-binding activity of the N-terminal immunoglobulin domain of sialoadhesin." Delputte P.L., Van Breedam W., Delrue I., Oetke C., Crocker P.R., Nauwynck H.J. J. Virol. 81:9546-9550 (2007)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.