Products for Research Use Only
RegisterLogin

NRG1-beta 1, Human

CAT: 0804-HY-P7365-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7365-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
NRG1-beta 1 Protein, a specific ligand for ERBB3, belongs to a family of structurally related polypeptide growth factors. NRG1-beta 1 Protein can regulate cell proliferation, differentiation, apoptosis and migration. NRG1-beta 1 Protein plays an important role in tumors and neurological diseases, and also has certain neuroprotective activity. NRG-1 Protein, Human is a recombinant NRG1-beta 1 protein expressed by E. coli without tags[1][2][3][4][5].
Product Name Alternative
NRG1-beta 1 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/recombinant-human-heregulin-1-beta1.html
Purity
98.0
Smiles
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
Molecular Formula
3084 (Gene_ID) Q02297-6 (S177-E241) (Accession)
Molecular Weight
Approximately 8 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Asrani K, et al. The HER2- and heregulin β1 (HRG) -inducible TNFR superfamily member Fn14 promotes HRG-driven breast cancer cell migration, invasion, and MMP9 expression. Mol Cancer Res. 2013 Apr;11 (4) :393-404.|[2]Curley MD, et al. Seribantumab, an Anti-ERBB3 Antibody, Delays the Onset of Resistance and Restores Sensitivity to Letrozole in an Estrogen Receptor-Positive Breast Cancer Model. Mol Cancer Ther. 2015 Nov;14 (11) :2642-52.|[3]Yao YL, et al. Proliferation of colorectal cancer is promoted by two signaling transduction expression patterns: ErbB2/ErbB3/AKT and MET/ErbB3/MAPK. PLoS One. 2013 Oct 30;8 (10) :e78086.|[4]Bi Y, et al. Nuclear ErbB2 represses DEPTOR transcription to inhibit autophagy in breast cancer cells. Cell Death Dis. 2021 Apr 14;12 (4) :397.|[5]Cui MY, et al. Neuregulin-1/PI3K signaling effects on oligodendrocyte proliferation, remyelination and behaviors deficit in a male mouse model of ischemic stroke. Exp Neurol. 2023 Apr;362:114323.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P73304-01NRG1-beta 2, Human
HY-P73744NRG1-beta 2, Human (HEK293, His)
HY-P73745NRG1-beta 2, Human (HEK293, Fc)
HY-174567Human NRG1 mRNA
HY-P74709-01Neuregulin-1/NRG1, Canine (HEK293)
HY-P702533-01Neuregulin-1/NRG1, Mouse (HEK293, His)
HY-P74712Neuregulin-1/NRG1, Canine (HEK293, His)
HY-P74713Neuregulin-1/NRG1, Canine (HEK293, hFc)
HY-P73326-01NRG1-alpha, Human (HEK293, His)
HY-P74711Neuregulin-1/NRG1, Canine (65a.a, HEK293, His)

Alternative Products

CatalogName
600341Human NRG1-beta
TMPY-03010-01NRG1 beta 1 Protein, Human, Recombinant
CD01197Recombinant Human NRG1- Beta 2 protein
Z05710-500NRG1 Beta 1 hFc Chimera, Human
377-HB-050Recombinant Human NRG1-beta 1/HRG1-beta 1 ECD
OK-0565Human NRG1-beta 1/HRG1-beta 1 ELISA Kit
DY377Human NRG1-beta 1/HRG1-beta 1 DuoSet ELISA
MBS8114605-01Human NRG1 Beta 1 HEK293 Overexpression Lysate
TMPS-00048-01NRG1 beta 1 Protein, Human, Recombinant (CHO)
TMPY-02705-01NRG1 beta 1 Protein, Human, Recombinant (hFc)

Popular Products