CELA2A, Mouse (His)

• Description :

  CELA2A Protein, a serine protease, is involved in the digestion of dietary proteins in the small intestine. It cleaves peptide bonds, breaking down proteins into smaller peptides and amino acids for absorption. CELA2A Protein, Mouse (His) is the recombinant mouse-derived CELA2A protein, expressed by E. coli , with N-6*His labeled tag.

• Product Name Alternative :

  CELA2A Protein, Mouse (His), Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/cela2a-protein-mouse-his.html

• Smiles :

  VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN

• Molecular Formula :

  13706 (Gene_ID) P05208 (V31-N271) (Accession)

• Molecular Weight :

  Approximately 29.7 kDa

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Scientific Category :

  Recombinant Proteins