Products for Research Use Only
RegisterLogin

ERP29, Human (GST)

CAT: 0804-HY-P71686Size: InquireDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71686Size:Inquire
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
UNSPSC Description
Contrary to expectations, the ERP29 protein does not exhibit disulfide isomerase activity. Its function is critical in the processing of secreted proteins within the endoplasmic reticulum (ER) and may contribute to the folding of proteins in this cellular compartment. ERP29 Protein, Human (GST) is the recombinant human-derived ERP29 protein, expressed by E. coli , with N-GST labeled tag.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/erp29-protein-human-gst.html
Smiles
PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF
Molecular Weight
Approximately 51.0 kDa
Shipping Conditions
Room temperature

Related Products

CatalogName
HY-RS04514ERP29 Human Pre-designed siRNA Set A
HY-P82048-01ERp29 Antibody (YA1793, Rabbit)
HY-RS19191Erp29 Mouse Pre-designed siRNA Set A
HY-RS25679Erp29 Rat Pre-designed siRNA Set A
HY-P71401-01UBE2G2, Human (GST)
HY-P701932ADH6, Human (GST)
HY-P705432IL1B, Human (GST)
HY-P704096VAV1, Human (GST)
HY-P704074CHMP1B, Human (GST)
HY-P71683RPS13, Human (GST)

Alternative Products

CatalogName
TMPH-01293-01ERP29 Protein, Human, Recombinant (GST)
373218-01ERP29, Recombinant, Human, aa40-251, GST-Tag (Endoplasmic Reticulum Resident Protein 29)
abx901774-01Human ERP29 siRNA
GTR19337005-01ERP29 siRNA (Human)
19443051ERP29 Adenovirus (Human)
EF009447Human ERP29 ELISA KIT
RP056895ERP29 Recombinant Protein (Human)
abx957482-01Human ERP29 shRNA Plasmid
E30P4409Recombinant Human ERP29 Protein
MBS8411224-01Human ERP29 Protein Lysate

Popular Products