Urocortin III, mouse (TFA)

• UNSPSC Description:

  Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2[1]. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics[2].

• Target Antigen:

  CRFR

• Type:

  Peptides

• Related Pathways:

  GPCR/G Protein

• Applications:

  Metabolism-protein/nucleotide metabolism

• Field of Research:

  Neurological Disease; Cardiovascular Disease; Endocrinology

• Assay Protocol:

  https://www.medchemexpress.com/urocortin-iii-mouse-tfa.html

• Purity:

  95.27

• Solubility:

  H2O : 25 mg/mL (ultrasonic)

• Smiles:

  [FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 (TFA salt)]

• Molecular Weight:

  4172.97 (free base)

• References & Citations:

  [1]Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7570-5. Lewis K, et al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor.|[2]Shemesh Y, et al. Ucn3 and CRF-R2 in the medial amygdala regulate complex social dynamics. Nat Neurosci. 2016 Nov;19(11):1489-1496.

• Shipping Conditions:

  Blue Ice

• Storage Conditions:

  -80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)

• Clinical Information:

  No Development Reported