Urocortin III, mouse (TFA)

CAT:
804-HY-P1858A-02
Size:
10 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Urocortin III, mouse (TFA) - image 1

Urocortin III, mouse (TFA)

  • UNSPSC Description:

    Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2[1]. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics[2].
  • Target Antigen:

    CRFR
  • Type:

    Peptides
  • Related Pathways:

    GPCR/G Protein
  • Applications:

    Metabolism-protein/nucleotide metabolism
  • Field of Research:

    Neurological Disease; Cardiovascular Disease; Endocrinology
  • Assay Protocol:

    https://www.medchemexpress.com/urocortin-iii-mouse-tfa.html
  • Purity:

    95.27
  • Solubility:

    H2O : 25 mg/mL (ultrasonic)
  • Smiles:

    [FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 (TFA salt)]
  • Molecular Weight:

    4172.97 (free base)
  • References & Citations:

    [1]Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7570-5. Lewis K, et al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor.|[2]Shemesh Y, et al. Ucn3 and CRF-R2 in the medial amygdala regulate complex social dynamics. Nat Neurosci. 2016 Nov;19(11):1489-1496.
  • Shipping Conditions:

    Blue Ice
  • Storage Conditions:

    -80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)
  • Clinical Information:

    No Development Reported