Products for Research Use Only
RegisterLogin

GITR, Human (HEK293, hFc)

CAT: 0804-HY-P70683-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70683-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
GITR (TNFRSF18) is a member of the TNFR superfamily. GITR promotes T cell activation and proliferation and increases resistance to tumors and viral infections, and exacerbates autoimmune diseases and inflammation processes[1]. GITR Protein, Human (HEK293, hFc) is a recombinant protein with a C-terminal Fc label, It consists of 136 amino acids (Q26-E161) and is produced in HEK293 cells.
Product Name Alternative
GITR Protein, Human (HEK293, hFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gitr-protein-human-hek-293-fc.html
Purity
95.0
Smiles
QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAE
Molecular Formula
8784 (Gene_ID) Q9Y5U5 (Q26-E161) (Accession)
Molecular Weight
42-50 kDa
References & Citations
[1]Tian J, et al. The Role of GITR/GITRL Interaction in Autoimmune Diseases. Front Immunol. 2020 Oct 9;11:588682.|[2]Krausz LT, et al. GITR-GITRL system, a novel player in shock and inflammation. ScientificWorldJournal. 2007 May 1;7:533-66.|[3]Shin HH, et al. Recombinant glucocorticoid induced tumor necrosis factor receptor (rGITR) induces NOS in murine macrophage. FEBS Lett. 2002 Mar 13;514 (2-3) :275-80.|[4]Liu Y, et al. Novel tumor suppressor function of glucocorticoid-induced TNF receptor GITR in multiple myeloma. PLoS One. 2013 Jun 13;8 (6) :e66982.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P73076GITR, Human (HEK293, His)
HY-P70822-01GITR, Human (T45A, HEK293, mFc)
HY-P75163-01GITR, Rat (HEK293, Fc)
HY-P78640-01GITR, Canine (HEK293, His)
HY-P75165GITR, Mouse (HEK293, Fc)
HY-P78716-01GITR, Cynomolgus (HEK293, Fc)
HY-P75164-01GITR, Mouse (HEK293, His)
HY-P76362GITR, Cynomolgus (HEK293, His)
HY-P705507CD164, Human (HEK293, hFc)
HY-P704500CEACAM6 , Human (HEK293, hFc)

Alternative Products

CatalogName
Z05358-100GITR/TNFRSF18 hFc Chimera, Human
MBS8115224-01Human GITR HEK293 Overexpression Lysate
E24C00127Human GITR HEK293 Cell Line
TMPY-04265-01GITR/TNFRSF18 Protein, Human, Recombinant (hFc)
MBS8121485-01GITR Protein, Human, Recombinant (hFc Tag)
MBS8575076-01Human GITR Protein, hFc-His tag
E51P02082GITR/TNFRSF18 Protein, Human, Recombinant (C-hFc)
bs-43566P-01Recombinant human CD26 protein, hFc (HEK293)
bs-43106P-01Recombinant human Osteocalcin, C-hFc (HEK293)
TMPY-05602-01GITR/TNFRSF18 Protein, Human, Recombinant (hFc & Avi), Biotinylated

Popular Products