IL-22, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


IL-22, Human
Description :
IL-22 Protein, Human is a cytokine protein and intricate member of the immune response.Product Name Alternative :
IL-22 Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsApplications :
COVID-19-immunoregulationAssay Protocol :
https://www.medchemexpress.com/cytokines/il-22-protein-human.htmlPurity :
98.0Smiles :
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACIMolecular Formula :
50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)Molecular Weight :
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.References & Citations :
[1]Nagem RA, et al. Crystal structure of recombinant human interleukin-22. Structure. 2002 Aug;10 (8) :1051-62.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

