Products for Research Use Only
RegisterLogin

IL-22, Mouse (His)

CAT: 0804-HY-P7079A-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7079A-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 Protein, Mouse (His) is the recombinant mouse-derived IL-22 protein, expressed by E. coli , with N-6*His labeled tag.
Product Name Alternative
IL-22 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-22-protein-mouse-his.html
Purity
95.0
Smiles
LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Molecular Formula
50929 (Gene_ID) Q9JJY9 (L34-V179) (Accession)
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Saxton RA, et al. The tissue protective functions of interleukin-22 can be decoupled from pro-inflammatory actions through structure-based design. Immunity. 2021 Apr 13;54 (4) :660-672.e9.|[2]Delbue D, et al. Reprogramming Intestinal Epithelial Cell Polarity by Interleukin-22. Front Med (Lausanne) . 2021 Apr 12;8:656047.|[3]Weathington NM, et al. Glycogen synthase kinase-3β stabilizes the interleukin (IL) -22 receptor from proteasomal degradation in murine lung epithelia. J Biol Chem. 2014 Jun 20;289 (25) :17610-9.|[4]Wei CC, et al. Cloning and characterization of mouse IL-22 binding protein. Genes Immun. 2003 Apr;4 (3) :204-11.|[5]Dudakov JA, et al. Interleukin-22: immunobiology and pathology. Annu Rev Immunol. 2015;33:747-85.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7039C-01IL-22, Human (His)
HY-P7079-01IL-22, Mouse
HY-P704134-01IL-22, Rat (HEK293, His)
HY-P704312IL-22 , Human (HEK293, His)
HY-P704144IL-22, Pig (HEK293, His)
HY-P704133IL-22, Rabbit (HEK293, His)
HY-P700743-01IL-22, Cynomolgus (HEK293, His)
HY-P704130IL-22, Canine (HEK293, His)
HY-P72793-01IL-22, Mouse (CHO)
HY-P73192IL-22, Human (P.pastoris, His)

Alternative Products

CatalogName
Z06204-100IL-22, His, Mouse
P516427Interleukin-22; IL-22 Protein (C-His, Mouse)
Z04670-100IL-22[Biotin], His & Avi, Mouse
HA211016-01Mouse IL-22, C-His Tag
P516160IL-22 Protein (C-His, Mouse)
591117-01IL-22, Recombinant, Mouse, His-Tag discontinued
GB300019-M-100μgRecombinant Mouse IL-22 Protein (His-tag)
E51P01929IL-22 Protein, Mouse, Recombinant (N-His)
MBS8434184-01Mouse IL-22 Recombinant Protein His Tag Lyophilized
PRP1110-01Mouse IL-22 Protein, His tag (Animal-Free)

Popular Products