Products for Research Use Only

TARC/CCL17, Human

CAT: 0804-HY-P7292-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7292-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
TARC/CCL17 Protein, Human is the first CC chemokine identified to interact with T cells with high affinity and bind to the CCR4 receptor to mediate inflammation, cancer, and autoimmune related diseases. TARC/CCL17 Protein, Human is a recombinant human TARC/CCL17 (A24-S94) protein expressed by E. coli[1][2].
Product Name Alternative
TARC/CCL17 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tarc-ccl17-protein-human.html
Purity
97.00
Smiles
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Molecular Formula
6361 (Gene_ID) Q92583 (A24-S94) (Accession)
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Julien Catherine, et al. What does elevated TARC/CCL17 expression tell us about eosinophilic disorders? Semin Immunopathol. 2021 Jun;43 (3) :439-458.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Yoshiki Mizukami, et al. CCL17 and CCL22 chemokines within tumor microenvironment are related to accumulation of Foxp3+ regulatory T cells in gastric cancer. Int J Cancer. 2008 May 15;122 (10) :2286-93.|[4]Amr A Al-haidari, et al. CCR4 mediates CCL17 (TARC) -induced migration of human colon cancer cells via RhoA/Rho-kinase signaling. Int J Colorectal Dis. 2013 Nov;28 (11) :1479-87.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins