Recombinant Lactobacillus delbrueckII subsp. bulgaricus Chaperonin GroEL (groEL) , partial

Recombinant Lactobacillus delbrueckII subsp. bulgaricus Chaperonin GroEL (groEL) , partial

• CAS Number: 9000-83-3
• Gene Name: groEL
• UniProt: Q1G937
• Expression Region: 182-374aa
• Organism: Lactobacillus delbrueckII subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
• Target Sequence: ETELSVVEGMQFDRGYLSQYMVTDNDKMEADLENPYILITDKKISNIQDILPMLQEIVQQGRSLLIIADDVTGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKEQLADIAALTGGTVISEDLGLELKDTQLSQLGQARRVTITKDSTTIVDGSGAKEAIQERVDTIRKQIEDTSSDFDKKKLQERLAKLTGGV
• Tag: C-terminal 6xHis-tagged
• Source: Yeast
• Field of Research: Others
• Assay Type: Developed Protein
• Relevance: Together with its co-chaperonin GroES, plays an essential role in assisting protein folding. The GroEL-GroES system forms a nano-cage that allows encapsulation of the non-native substrate proteins and provides a physical environment optimized to promote and accelerate protein folding.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Partial
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 22.7 kDa
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.