G-CSF, Human (CHO)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


G-CSF, Human (CHO)
Description :
G-CSF Protein, Human (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.Product Name Alternative :
G-CSF Protein, Human (CHO), Human, CHOUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/g-csf-protein-human-cho.htmlPurity :
96Smiles :
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQPMolecular Formula :
1440 (Gene_ID) Q8N4W3 (T27-P200) /P09919-2 (T31-P204) (Accession)Molecular Weight :
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.References & Citations :
[1]Demetri GD, et al. Granulocyte Colony Stimulating Factor and its receptor. Blood. 1991 Dec 1;78 (11) :2791-808.|[2]Shah J, et al. The clinical use of granulocyte-colony stimulating factor. Br J Hosp Med (Lond) . 2014 Feb;75 (2) :C29-32.|[3]Panopoulos AD, et al. Granulocyte colony-stimulating factor: molecular mechanisms of action during steady state and 'emergency' hematopoiesis. Cytokine. 2008 Jun;42 (3) :277-88.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

