G-CSF, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


G-CSF, Human
Description :
Granulocyte colony-stimulating factor (G-CSF) is a glycoprotein secreted by the cells of the immune system, fibroblasts and endothelium, which acts as a hematopoietic and endothelial precursor cells cytokine. G-CSF stimulates maturation of progenitor cells in the bone marrow into differentiated granulocytes, macrophages and the T cells. G-CSF also shows to convey neuroprotection to central neurons upon increases in phosphorylation of PI3K/Akt pathway and regulates epithelial to mesenchymal transition in cancer. G-CSF Protein (Human) is a recombinant protein with tag free that consists of 200 or 204 amino acids, which is expressed in E. coli[1][2][3][4][5][6][7][8].Product Name Alternative :
G-CSF Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/g-csf-protein-human.htmlPurity :
98.00Smiles :
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQPMolecular Formula :
1440 (Gene_ID) Q8N4W3 (T27-P200) /P09919-2 (T31-P204) (Accession)Molecular Weight :
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.References & Citations :
[1]Aliper AM, et al. A role for G-CSF and GM-CSF in nonmyeloid cancers. Cancer Med. 2014 Aug;3 (4) :737-46.|[2]Wright CR, et al. Granulocyte Colony-Stimulating Factor and Its Potential Application for Skeletal Muscle Repair and Regeneration. Mediators Inflamm. 2017;2017:7517350.|[3]Liu M, et al. The Effect of Granulocyte Colony-Stimulating Factor on the Progression of Atherosclerosis in Animal Models: A Meta-Analysis. Biomed Res Int. 2017;2017:6705363.|[4]Shaked Y, et al. Contribution of granulocyte colony-stimulating factor to the acute mobilization of endothelial precursor cells by vascular disrupting agents. Cancer Res. 2009 Oct 1;69 (19) :7524-8.|[5]Phan VT, et al. Oncogenic RAS pathway activation promotes resistance to anti-VEGF therapy through G-CSF-induced neutrophil recruitment. Proc Natl Acad Sci U S A. 2013 Apr 9;110 (15) :6079-84. |[6]Galván ST, et al. Plasma concentrations of granulocyte colony-stimulating factor (G-CSF) in patients with substance use disorders and comorbid major depressive disorder. Sci Rep. 2021 Jul 1;11 (1) :13629.|[7]Ding J, et al. M2 macrophage-derived G-CSF promotes trophoblasts EMT, invasion and migration via activating PI3K/Akt/Erk1/2 pathway to mediate normal pregnancy. J Cell Mol Med. 2021 Feb;25 (4) :2136-2147. |[8]Liu Z, et al. G-CSF promotes the viability and angiogenesis of injured liver via direct effects on the liver cells. Mol Biol Rep. 2022 Sep;49 (9) :8715-8725.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

